General Information

  • ID:  hor003850
  • Uniprot ID:  Q9YGK5
  • Protein name:  Corticotropin
  • Gene name:  pomcb
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPIKVYTNGVEEESAESLPAEM
  • Length:  39
  • Propeptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRAQCWEDARCRDLTTDENILNCIQLCRSDLTDETPVYPGESHLQPPSELEQAEVLEPLSPAALAPAEQMDPESSPRHELKRSYSMEHFRWGKPVGRKRRPIKVYTNGVEEESAESLPAEMRRELATNEVNHPQEDSALIQQKKKDGSYKMKHFRWSSPPAGKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Signal peptide:  MVRGVRMLCPAWLLALAVLCAGGSEVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK5-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003850_AF2.pdbhor003850_ESM.pdb

Physical Information

Mass: 523108 Formula: C200H312N58O60S2
Absent amino acids: CDQ Common amino acids: E
pI: 9.1 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -101.79 Boman Index: -10653
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 47.44
Instability Index: 6411.54 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  9806347
  • Title:  Cloning and expression of two proopiomelanocortin mRNAs in the common carp (Cyprinus carpio L.).